2002 Archives by author

Messages sorted by: [ thread ] [ subject ] [ date ]
More info on this list...

Starting: Wed Jan 23 10:58:16 CET 2002
Ending: Mon Dec 30 17:34:13 CET 2002
Messages: 109

3-DNET® - Internet Resumes do NOT work ! 3-DNET
KOI8-R encoding in reports Vladimir Antropov
Question for installation Arthur Au-Yeung
building Lire from current CVS, gnu autotools hassle Joost van Baal
html with graphs on Mandrake 8.1 (was: Re: help) Joost van Baal
writing report specifications: field name=? (was: Re: Field definition) Joost van Baal
How to know version ? Joost van Baal
no charts in html report Joost van Baal
massively incorrect output from Postfix log? Joost van Baal
massively incorrect output from Postfix log? Joost van Baal
How to know version ? Joost van Baal
missing XML::Parser on Slackware Linux v 8.1 (was: Re: Error) Joost van Baal
lr_log2xml doesn't accept compressed input Joost van Baal
dlf generated by postfix convertor: what is an email message when virusscanner and aliases are involved? (was: Re: summarizing postfix logs problem(s)) Joost van Baal
sendmail2dlf problem? : from=<> shows up as - Joost van Baal
merging 2 xml reports into another one Joost van Baal
merging 2 xml reports into another one Joost van Baal
Question for installation Joost van Baal
Generating HTML reports on Slackware Linux (was: Re: Question for installation) Joost van Baal
massively incorrect output from Postfix log? Bill Bradford
massively incorrect output from Postfix log? Bill Bradford
summarizing postfix logs problem(s) Razvan Cosma
Are you looking for a new or re-designed website, better hosting or domain names? A1 Website Design
xsltproc catalog.xml:1: error: Space needed here Rob Dinoff
generating www reports on subdirecties of website (was: Re: lire optie? ...) Stijn van Dongen
Real Server log format supported rmaccess.log Elsner
Here we are ....... CMax Europe
No subject Arnaud Gaillard
JMeter: Log reporting from XML log format Atif Ghaffar
Slash Interest Rates! (v1Uu) Leventer Hodek
Hello My Friend Jose
additional reports Matthias Jung
Running logreport on MacOS X 10.2 as non-root... Brad Knowles
Complete list of supported programs/formats? Brad Knowles
Complete list of supported programs/formats? Brad Knowles
Running logreport on MacOS X 10.2 as non-root... Josh Koenig
Logreport from Sendmail sort by sender and recipients Nico Kretschmar
AW: AW: AW: Logreport from Sendmail sort by sender and recipients Nico Kretschmar
Read the FAQs.... Nico Kretschmar
xsltproc catalog.xml:1: error: Space needed here Francis J. Lacoste
Empty report Francis J. Lacoste
no charts in html report Francis J. Lacoste
firewall-1 log Francis J. Lacoste
additional reports Francis J. Lacoste
LIRE Francis J. Lacoste
Problem with logreport Francis J. Lacoste
KOI8-R encoding in reports Francis J. Lacoste
merging 2 xml reports into another one Francis J. Lacoste
Announcing Lire 1.2 Release Candidate 1 Francis J. Lacoste
Real Server log format supported rmaccess.log Francis J. Lacoste
Logreport from Sendmail sort by sender and recipients Francis J. Lacoste
1970 Francis J. Lacoste
Complete list of supported programs/formats? Francis J. Lacoste
AW: AW: AW: Logreport from Sendmail sort by sender and recipients Francis J. Lacoste
newbie - no content in report Francis J. Lacoste
newbie - no content in report Francis J. Lacoste
lr_xml2chart err can't open EPS input file Francis J. Lacoste
lr_xml2chart err can't open EPS input file Francis J. Lacoste
JMeter: Log reporting from XML log format Francis J. Lacoste
postfix reject log Francis J. Lacoste
postfix reject log Francis J. Lacoste
Powerball Results Saturday September 14, 2002 Estimated Jackpot $100 Million Powerball Lottery
Greetings. Mallam.Usman M.Yerimah.
LIRE Malcolm Mallett
help Christian Martz
no charts in html report Christian Martz
no charts in html report Christian Martz
newbie - no content in report Edward Quick
newbie - no content in report Edward Quick
newbie - no content in report Edward Quick
newbie - no content in report Edward Quick
lr_xml2chart err can't open EPS input file Edward Quick
lr_xml2chart err can't open EPS input file Edward Quick
lr_xml2chart err can't open EPS input file Edward Quick
Problem with logreport Niels Ruiter
Empty report Carlos Santos
Melt the Heart of your Valentine with this beautiful Screen saver Screen Saver
Melt the Heart of your Valentine with this beautiful Screen saver Screen Saver
Melt the Heart of your Valentine with this beautiful Screen saver Screen Saver
postfix reject log Andy Thompson
postfix reject log Andy Thompson
postfix reject log Andy Thompson
firewall-1 log Oscar Castaneda V.
1970 Gerhard Venter
1970 Gerhard Venter
Unidentified subject! Faye William
Goodday Oluwafunmi Williams
Best Development Manual Hengel Zambrano
Bulk Email Sending & Bullet Proof Web Hosting ashford
Bulk Email Sending & Bullet Proof Web Hosting cher_san
bussiness proposal hassan dangote
[±¤°í] ÀÎÅÍ³Ý ±¤°í ÇÁ·Î±×·¥ÀÔ´Ï´Ù. eCapture
from=<> shows up as - anthony and grethen
Field definition gross, cedric
How to know version ? gross, cedric
How to know version ? gross, cedric
<±¤°í>==>ºÎ¸ð´Ô²²¼ ¾ÆÁ÷µµ ´Ù¸®ÅëÁõÀ¸·Î °íÅë¹Þ°í °è½Ã³ª¿ä? aqq86 at hotmail.net
Sendmail log brendon male
Wanna Big Penis! mani280885
Content Management (7016jyPk at 8) Chloe100612 at msn.com
Building Your Practice (1178piJl5-253vsmZ6596 at 20) Chloe568563 at msn.com
udb2sampledb1db2desktopbotinfsbotsdb2botinfsservicedb2botsbotsservicesdb2sampledesktopserviceservicebotinfssampleserviceservicedesktopbotinfsservicesampledb2db2botsdb1botinfsdb1sampledb1service user at otherhost.mydomain.com
merging 2 xml reports into another one rfv
Web Content Management (8332RDXt9-420Cq at 14) Kattie228404 at yahoo.com
Free Online Seminar on Developing a Dynamic E-business Strategy! panagrow at yahoo.com
<±¤°í> ´Ù¸® ÅëÁõÀ¸·Î °íÅë¹Þ´Â ¾î¸£½Å¿¡°Ô ±ÇÇÕ´Ï´Ù... ÀºÈñÁ¤
<±¤°í>´Ù¸® ÅëÁõÀ¸·Î °íÅë¹Þ´Â ¾î¸£½Å¿¡°Ô ±ÇÇÕ´Ï´Ù. ÀÌ°æÈñ
PersonalDB.net 회원으로 초대받으셨습니다. [홍 보] 관리자
지긋지긋한 무좀 더이상 고민하지 마세요!!![광고] 이프리콜

Last message date: Mon Dec 30 17:34:13 CET 2002
Archived on: Sat May 26 18:19:38 CEST 2007

Messages sorted by: [ thread ] [ subject ] [ date ]
More info on this list...

This archive was generated by Pipermail 0.09 (Mailman edition).